PDB entry 1qil

View 1qil on RCSB PDB site
Description: inactive mutant toxic shock syndrome toxin-1 at 2.5 a
Deposited on 1997-03-27, released 1997-08-12
The last revision prior to the SCOP 1.57 freeze date was dated 1997-08-12, with a file datestamp of 1997-08-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.202
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qilA (A:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeiraqltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qilB (B:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeiraqltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qilC (C:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeiraqltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein