PDB entry 1qht

View 1qht on RCSB PDB site
Description: dna polymerase from thermococcus sp. 9on-7 archaeon
Deposited on 1999-05-26, released 2000-05-26
The last revision prior to the SCOP 1.57 freeze date was dated 2000-06-04, with a file datestamp of 2000-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.245
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qhtA (A:)
    mildtdyitengkpvirvfkkengefkieydrtfepyfyallkddsaiedvkkvtakrhg
    tvvkvkraekvqkkflgrpievwklyfnhpqdvpairdrirahpavvdiyeydipfakry
    lidkglipmegdeeltmlafaiatlyhegeefgtgpilmisyadgsearvitwkkidlpy
    vdvvstekemikrflrvvrekdpdvlityngdnfdfaylkkrceelgikftlgrdgsepk
    iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgkpkekvyaeeiaqawe
    sgeglervarysmedakvtyelgreffpmeaqlsrligqslwdvsrsstgnlvewfllrk
    aykrnelapnkpderelarrrggyaggyvkeperglwdnivyldfrslypsiiithnvsp
    dtlnregckeydvapevghkfckdfpgfipsllgdlleerqkikrkmkatvdplekklld
    yrqraikilansfygyygyakarwyckecaesvtawgreyiemvireleekfgfkvlyad
    tdglhatipgadaetvkkkakeflkyinpklpglleleyegfyvrgffvtkkkyavidee
    gkittrgleivrrdwseiaketqarvleailkhgdveeavrivkevteklskyevppekl
    viheqitrdlrdykatgphvavakrlaargvkirpgtvisyivlkgsgrigdraipadef
    dptkhrydaeyyienqvlpaverilkafgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qhtA (A:)
    mildtdyitengkpvirvfkkengefkieydrtfepyfyallkddsaiedvkkvtakrhg
    tvvkvkraekvqkkflgrpievwklyfnhpqdvpairdrirahpavvdiyeydipfakry
    lidkglipmegdeeltmlafaiatlyhegeefgtgpilmisyadgsearvitwkkidlpy
    vdvvstekemikrflrvvrekdpdvlityngdnfdfaylkkrceelgikftlgrdgsepk
    iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgkpkekvyaeeiaqawe
    sgeglervarysmedakvtyelgreffpmeaqlsrligqslwdvsrsstgnlvewfllrk
    aykrnelapnkpderelarrrggyaggyvkeperglwdnivyldfrslypsiiithnvsp
    dtlnregckeydvapevghkfckdfpgfipsllgdlleerqkikrkmkatvdplekklld
    yrqraikilansfygyygyakarwyckecaesvtawgreyiemvireleekfgfkvlyad
    tdglhatipgadaetvkkkakeflkyinleleyegfyvrgffvtkkkyavideegkittr
    gleivrrdwseiaketqarvleailkhgdveeavrivkevtlviheqiatgphvavakrl
    aargvkirpgtvisyivlkgdraipadefeyyienqvlpaverilkafgy