PDB entry 1qho

View 1qho on RCSB PDB site
Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose/acarbose complex
Deposited on 1999-05-25, released 2000-05-31
The last revision prior to the SCOP 1.69 freeze date was dated 2000-05-31, with a file datestamp of 2000-05-31.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.151
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qhoA (A:)
    sssasvkgdviyqiiidrfydgdttnnnpaksyglydptkskwkmywggdlegvrqklpy
    lkqlgvttiwlspvldnldtlagtdntgyhgywtrdfkqieehfgnwttfdtlvndahqn
    gikvivdfvpnhstpfkandstfaeggalynngtymgnyfddatkgyfhhngdisnwddr
    yeaqwknftdpagfsladlsqengtiaqyltdaavqlvahgadglridavkhfnsgfsks
    ladklyqkkdiflvgewygddpgtanhlekvryannsgvnvldfdlntvirnvfgtftqt
    mydlnnmvnqtgneykykenlitfidnhdmsrflsvnsnkanlhqalafiltsrgtpsiy
    ygteqymaggndpynrgmmpafdttttafkevstlaglrrnnaaiqygtttqrwinndvy
    iyerkffndvvlvainrntqssysisglqtalpngsyadylsgllggngisvsngsvasf
    tlapgavsvwqystsasapqigsvapnmgipgnvvtidgkgfgttqgtvtfggvtatvks
    wtsnrievyvpnmaagltdvkvtaggvssnlysynilsgtqtsvvftvksapptnlgdki
    yltgnipelgnwstdtsgavnnaqgpllapnypdwfyvfsvpagktiqfkffikradgti
    qwengsnhvattptgatgnitvtwqn