PDB entry 1qh4

View 1qh4 on RCSB PDB site
Description: crystal structure of chicken brain-type creatine kinase at 1.41 angstrom resolution
Class: transferase
Keywords: brain-type creatine kinase, cancer, cellular energy metabolism, guanidino kinase, neurodegenerative disorders, transferase
Deposited on 1999-05-11, released 1999-11-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: 0.137
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creatine kinase
    Species: Gallus gallus [TaxId:9031]
    Gene: EMBL-NR. X03509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qh4a1, d1qh4a2
  • Chain 'B':
    Compound: creatine kinase
    Species: Gallus gallus [TaxId:9031]
    Gene: EMBL-NR. X03509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qh4b1, d1qh4b2
  • Chain 'C':
    Compound: creatine kinase
    Species: Gallus gallus [TaxId:9031]
    Gene: EMBL-NR. X03509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qh4c1, d1qh4c2
  • Chain 'D':
    Compound: creatine kinase
    Species: Gallus gallus [TaxId:9031]
    Gene: EMBL-NR. X03509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qh4d1, d1qh4d2
  • Heterogens: CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qh4A (A:)
    pfsnshnllkmkysvddeypdlsvhnnhmakvltldlykklrdrqtssgftlddviqtgv
    dnpghpfimtvgcvagdeesyevfkelfdpviedrhggykptdehktdlnadnlqggddl
    dpnyvlssrvrtgrsirgfclpphcsrgerraieklsvealgslggdlkgkyyalrnmtd
    aeqqqliddhflfdkpvsplllasgmardwpdargiwhndnktflvwineedhlrvismq
    kggnmkevftrfctgltqietlfksknyefmwnphlgyiltcpsnlgtglragvhiklpn
    lgkhekfgevlkrlrlqkrgtggvdtaavggvfdvsnadrlgfsevelvqmvvdgvklli
    emekrlekgqsiddlmpaqk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qh4B (B:)
    pfsnshnllkmkysvddeypdlsvhnnhmakvltldlykklrdrqtssgftlddviqtgv
    dnpghpfimtvgcvagdeesyevfkelfdpviedrhggykptdehktdlnadnlqggddl
    dpnyvlssrvrtgrsirgfclpphcsrgerraieklsvealgslggdlkgkyyalrnmtd
    aeqqqliddhflfdkpvsplllasgmardwpdargiwhndnktflvwineedhlrvismq
    kggnmkevftrfctgltqietlfksknyefmwnphlgyiltcpsnlgtglragvhiklpn
    lgkhekfgevlkrlrlqkrgtggvdtaavggvfdvsnadrlgfsevelvqmvvdgvklli
    emekrlekgqsiddlmpaqk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qh4C (C:)
    pfsnshnllkmkysvddeypdlsvhnnhmakvltldlykklrdrqtssgftlddviqtgv
    dnpghpfimtvgcvagdeesyevfkelfdpviedrhggykptdehktdlnadnlqggddl
    dpnyvlssrvrtgrsirgfclpphcsrgerraieklsvealgslggdlkgkyyalrnmtd
    aeqqqliddhflfdkpvsplllasgmardwpdargiwhndnktflvwineedhlrvismq
    kggnmkevftrfctgltqietlfksknyefmwnphlgyiltcpsnlgtglragvhiklpn
    lgkhekfgevlkrlrlqkrgtggvdtaavggvfdvsnadrlgfsevelvqmvvdgvklli
    emekrlekgqsiddlmpaqk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qh4D (D:)
    pfsnshnllkmkysvddeypdlsvhnnhmakvltldlykklrdrqtssgftlddviqtgv
    dnpghpfimtvgcvagdeesyevfkelfdpviedrhggykptdehktdlnadnlqggddl
    dpnyvlssrvrtgrsirgfclpphcsrgerraieklsvealgslggdlkgkyyalrnmtd
    aeqqqliddhflfdkpvsplllasgmardwpdargiwhndnktflvwineedhlrvismq
    kggnmkevftrfctgltqietlfksknyefmwnphlgyiltcpsnlgtglragvhiklpn
    lgkhekfgevlkrlrlqkrgtggvdtaavggvfdvsnadrlgfsevelvqmvvdgvklli
    emekrlekgqsiddlmpaqk