PDB entry 1qgz

View 1qgz on RCSB PDB site
Description: ferredoxin:nadp+ reductase mutant with leu 78 replaced by asp (l78d)
Deposited on 1999-05-10, released 2002-02-27
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-27, with a file datestamp of 2002-02-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.177
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qgzA (A:)
    dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
    kngkpeklrdysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
    evkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfsw
    lvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlw
    qliknqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety