PDB entry 1qgw

View 1qgw on RCSB PDB site
Description: crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas cs24
Class: photosynthesis
Keywords: phycoerythrin, light-harvesting protein, cryptophyte, phycobilin
Deposited on 1999-05-10, released 1999-05-19
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.149
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cryptophytan phycoerythrin (alpha-1 chain))
    Species: Rhodomonas sp.
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00433 (0-75)
      • hydroxylation (3)
      • conflict (9)
    Domains in SCOP 1.75: d1qgwa_
  • Chain 'B':
    Compound: protein (cryptophytan phycoerythrin (alpha-2 chain))
    Species: Rhodomonas sp.
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00433 (0-66)
      • hydroxylation (3)
    Domains in SCOP 1.75: d1qgwb_
  • Chain 'C':
    Compound: protein (cryptophytan phycoerythrin (beta chain))
    Species: Rhodomonas sp.
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27198 (Start-176)
      • conflict (49)
      • conflict (55)
      • conflict (60)
      • conflict (64)
      • methylation (71)
      • conflict (72)
    Domains in SCOP 1.75: d1qgwc_
  • Chain 'D':
    Compound: protein (cryptophytan phycoerythrin (beta chain))
    Species: Rhodomonas sp.
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27198 (0-176)
      • conflict (49)
      • conflict (55)
      • conflict (60)
      • conflict (64)
      • methylation (71)
      • conflict (72)
    Domains in SCOP 1.75: d1qgwd_
  • Heterogens: CL, MG, DBV, PEB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qgwA (A:)
    amdksakapqitifdhrgcsrapkestggkaggqddemmvkvastkvtvsesdaakklqe
    fitfekgidgpftskn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qgwB (B:)
    amdksakapvitifdhrgcsrapkeytgakaggkddemmvkaqsvkievstgtaegvlat
    slakmtk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qgwC (C:)
    mldafsrvvtnadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmi
    cenpslispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketyssl
    gvpansnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qgwC (C:)
    dafsrvvaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmicenpslis
    psgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketysslgvpansna
    ravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qgwD (D:)
    mldafsrvvtnadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmi
    cenpslispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketyssl
    gvpansnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais