PDB entry 1qgw

View 1qgw on RCSB PDB site
Description: crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas cs24
Deposited on 1999-05-10, released 1999-05-19
The last revision prior to the SCOP 1.55 freeze date was dated 1999-08-31, with a file datestamp of 1999-08-30.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.149
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qgwa_
  • Chain 'B':
    Domains in SCOP 1.55: d1qgwb_
  • Chain 'C':
    Domains in SCOP 1.55: d1qgwc_
  • Chain 'D':
    Domains in SCOP 1.55: d1qgwd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qgwA (A:)
    amdksakapqitifdhrgcsrapkestggkaggqddemmvkvastkvtvsesdaakklqe
    fitfekgidgpftskn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qgwB (B:)
    amdksakapvitifdhrgcsrapkeytgakaggkddemmvkaqsvkievstgtaegvlat
    slakmtk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qgwC (C:)
    dafsrvvtnadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmice
    npslispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketysslgv
    pansnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qgwC (C:)
    dafsrvvaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmicenpslis
    psgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketysslgvpansna
    ravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qgwD (D:)
    mldafsrvvtnadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmi
    cenpslispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketyssl
    gvpansnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais