PDB entry 1qgm

View 1qgm on RCSB PDB site
Description: the solution structure of a 30 residue amino-terminal domain of the carp granulin-1 protein.
Deposited on 1999-05-01, released 1999-12-22
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qgma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qgmA (A:)
    vihcdaaticpdgttcslspygvwycspfs