PDB entry 1qgj

View 1qgj on RCSB PDB site
Description: arabidopsis thaliana peroxidase n
Class: oxidoreductase
Keywords: peroxidase, oxidoreductase
Deposited on 1999-04-29, released 2000-03-08
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.17
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxidase n
    Species: Arabidopsis thaliana
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qgja_
  • Chain 'B':
    Compound: peroxidase n
    Species: Arabidopsis thaliana
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qgjb_
  • Heterogens: CA, HEM, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qgjA (A:)
    qlspdiyakscpnlvqivrkqvaialkaeirmaaslirlhfhdcfvngcdasllldgads
    eklaipninsargfevidtikaavenacpgvvscadiltlaardsvvlsggpgwrvalgr
    kdglvanqnsannlpspfepldaiiakfvavnlnitdvvalsgahtfgqakcavfsnrlf
    nftgagnpdatletsllsnlqtvcplggnsnitapldrsttdtfdnnyfknllegkglls
    sdqilfssdlavnttkklveaysrsqslffrdftcamirmgnisngasgevrtncrvinn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qgjB (B:)
    qlspdiyakscpnlvqivrkqvaialkaeirmaaslirlhfhdcfvngcdasllldgads
    eklaipninsargfevidtikaavenacpgvvscadiltlaardsvvlsggpgwrvalgr
    kdglvanqnsannlpspfepldaiiakfvavnlnitdvvalsgahtfgqakcavfsnrlf
    nftgagnpdatletsllsnlqtvcplggnsnitapldrsttdtfdnnyfknllegkglls
    sdqilfssdlavnttkklveaysrsqslffrdftcamirmgnisngasgevrtncrvinn