PDB entry 1qgi

View 1qgi on RCSB PDB site
Description: chitosanase from bacillus circulans
Class: hydrolase
Keywords: hydrolase, chitosan degradation
Deposited on 1999-04-28, released 1999-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.192
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (chitosanase)
    Species: Bacillus circulans [TaxId:1397]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33673 (0-258)
      • cloning artifact (76-77)
      • cloning artifact (79)
      • cloning artifact (81)
      • cloning artifact (97)
      • cloning artifact (157)
      • insertion (158)
      • cloning artifact (159)
    Domains in SCOPe 2.07: d1qgia_
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qgiA (A:)
    aspddnfspetlqflrnntgldgeqwnnimklinkpeqddlnwikyygycediedergyt
    iglfgattggsrdthpdgpdlfkaydaakgasnpsadgalkrlgingkmkgsileikdse
    kvfcgkikklqndaawrkamwetfynvyirysveqarqrgftsavtigsfvdtalnqgat
    ggsdtlqgllarsgsssnektfmknfhakrtlvvdtnkynkppngknrvkqwdtlvdmgk
    mnlknvdseiaqvtdwemk