PDB entry 1qgd

View 1qgd on RCSB PDB site
Description: transketolase from escherichia coli
Deposited on 1999-04-23, released 2003-06-17
The last revision prior to the SCOP 1.69 freeze date was dated 2003-06-17, with a file datestamp of 2003-06-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.132
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qgdA (A:)
    ssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrfv
    lsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgktagvetttgplgqgia
    navgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgkliaf
    yddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsll
    mcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeagq
    akesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrkas
    qnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiangi
    slhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqvas
    lrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniarggy
    vlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresvl
    pkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakake
    ll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qgdB (B:)
    ssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrfv
    lsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgktagvetttgplgqgia
    navgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgkliaf
    yddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsll
    mcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeagq
    akesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrkas
    qnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiangi
    slhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqvas
    lrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniarggy
    vlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresvl
    pkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakake
    ll