PDB entry 1qga

View 1qga on RCSB PDB site
Description: pea fnr y308w mutant in complex with nadp+
Class: oxidoreductase
Keywords: flavoenzyme, photosynthesis, electron transfer, hydride transfer, oxidoreductase
Deposited on 1999-04-18, released 1999-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ferredoxin:nadp+ reductase)
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10933
      • mutation (307)
    Domains in SCOPe 2.07: d1qgaa1, d1qgaa2
  • Chain 'B':
    Compound: protein (ferredoxin:nadp+ reductase)
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10933 (Start-307)
      • mutation (307)
    Domains in SCOPe 2.07: d1qgab1, d1qgab2
  • Heterogens: SO4, FAD, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qgaA (A:)
    qvtteapakvvkhskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfsteg
    evpyregqsigivpdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndage
    vvkgvcsnflcdlkpgsevkitgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmff
    ekhedyqfnglawlflgvptsssllykeefekmkekapenfrldfavsreqvndkgekmy
    iqtrmaqyaeelwellkkdntfvymcglkgmekgiddimvslaakdgidwieykrtlkka
    eqwnvevw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qgaB (B:)
    qvtteapakvvkhskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfsteg
    evpyregqsigivpdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndage
    vvkgvcsnflcdlkpgsevkitgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmff
    ekhedyqfnglawlflgvptsssllykeefekmkekapenfrldfavsreqvndkgekmy
    iqtrmaqyaeelwellkkdntfvymcglkgmekgiddimvslaakdgidwieykrtlkka
    eqwnvevw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qgaB (B:)
    skkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigiv
    pdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndagevvkgvcsnflcdl
    kpgsevkitgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmffekhedyqfnglaw
    lflgvptsssllykeefekmkekapenfrldfavsreqvndkgekmyiqtrmaqyaeelw
    ellkkdntfvymcglkgmekgiddimvslaakdgidwieykrtlkkaeqwnvevw