PDB entry 1qg1

View 1qg1 on RCSB PDB site
Description: growth factor receptor binding protein sh2 domain complexed with an shc-derived peptide
Class: hormone/growth factor
Keywords: signal transduction, sh2 domain, phosphotyrosyl peptide, complex (signal transduction/peptide)
Deposited on 1999-04-19, released 1999-04-27
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'E':
  Compound: protein (growth factor receptor binding protein)
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62993 (2-103)
    • cloning artifact (0-1)
  Domains in SCOP 1.75: d1qg1e_
• Chain 'I':
  Compound: protein (shc-derived peptide)
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29353 (0-12)
    • modified residue (4)

PDB Chain Sequences:

• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qg1E (E:)
  gshpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
  gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqpt
  

  
  
• Chain 'I':
  No sequence available.