PDB entry 1qg0

View 1qg0 on RCSB PDB site
Description: wild-type pea fnr
Deposited on 1999-04-18, released 1999-04-27
The last revision prior to the SCOP 1.55 freeze date was dated 1999-09-01, with a file datestamp of 1999-08-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.218
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qg0A (A:)
    hskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigi
    vpdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndagevvkgvcsnflcd
    lkpgsevkitgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmffekhedyqfngla
    wlflgvptsssllykeefekmkekapenfrldfavsreqvndkgekmyiqtrmaqyaeel
    wellkkdntfvymcglkgmekgiddimvslaakdgidwieykrtlkkaeqwnvevy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qg0B (B:)
    hskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigi
    vpdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndagevvkgvcsnflcd
    lkpgsevkitgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmffekhedyqfngla
    wlflgvptsssllykeefekmkekapenfrldfavsreqvndkgekmyiqtrmaqyaeel
    wellkkdntfvymcglkgmekgiddimvslaakdgidwieykrtlkkaeqwnvevy