PDB entry 1qfz

View 1qfz on RCSB PDB site
Description: pea fnr y308s mutant in complex with nadph
Deposited on 1999-04-18, released 1999-04-27
The last revision prior to the SCOP 1.59 freeze date was dated 1999-09-01, with a file datestamp of 1999-08-31.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.201
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qfzA (A:)
    qvtteapakvvkhskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfsteg
    evpyregqsigivpdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndage
    vvkgvcsnflcdlkpgsevkitgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmff
    ekhedyqfnglawlflgvptsssllykeefekmkekapenfrldfavsreqvndkgekmy
    iqtrmaqyaeelwellkkdntfvymcglkgmekgiddimvslaakdgidwieykrtlkka
    eqwnvevs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qfzB (B:)
    skkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigiv
    pdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndagevvkgvcsnflcdl
    kpgsevkitgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmffekhedyqfnglaw
    lflgvptsssllykeefekmkekapenfrldfavsreqvndkgekmyiqtrmaqyaeelw
    ellkkdntfvymcglkgmekgiddimvslaakdgidwieykrtlkkaeqwnvevs