PDB entry 1qfw

View 1qfw on RCSB PDB site
Description: ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti beta subunit
Deposited on 1999-04-15, released 2000-04-26
The last revision prior to the SCOP 1.65 freeze date was dated 2000-04-26, with a file datestamp of 2000-04-26.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.26
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1qfwa_
  • Chain 'B':
    Domains in SCOP 1.65: d1qfwb_
  • Chain 'H':
    Domains in SCOP 1.65: d1qfwh_
  • Chain 'I':
    Domains in SCOP 1.65: d1qfwi_
  • Chain 'L':
    Domains in SCOP 1.65: d1qfwl_
  • Chain 'M':
    Domains in SCOP 1.65: d1qfwm_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qfwA (A:)
    apdtqdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestcc
    vaksynrvtvmggfkvenhtachcstcyyhks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qfwA (A:)
    dcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestccvaksy
    nrvtvmggfkvenhtachcstcyyhks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qfwB (B:)
    skeplrprcrpinatlavekegcpvcitvntticagycptmtrvlqgvlpalpqvvcnyr
    dvrfesirlpgcprgvnpvvsyavalscqcalcrrsttdcggpkdhpltcddprfqdsss
    skapppslpspsrlpgpsdtpilpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qfwB (B:)
    keplrprcrpinatlavekegcpvcitvntticagycptmtrvlqgvlpalpqvvcnyrd
    vrfesirlpgcprgvnpvvsyavalscqcalcrrsttdcggpkdhpltcdd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1qfwH (H:)
    qvqlqqsgaelvkpgasvklsckasdytftsywmhwvkqrpgqglewigeinptngrtyy
    nekfkskatltvaasastaamqassltsedsavyycarrygnsfdywgqgttvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qfwH (H:)
    qlqqsgaelvkpgasvklsckasdytftsywmhwvkqrpgqglewigeinptngrtyyne
    kkatltvaasastaamqassltsedsavyycarrygnsfdywgqgttvtvss
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1qfwI (I:)
    qvqlqesgghlvkpggslklscaasgfafssfdmswirqtpekrlewvasitnvgtytyy
    pgsvkgrfsisrdnarntlnlqmsslrsedtalyfcarqgtaaqpywyfdvwgagttvtv
    ss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qfwI (I:)
    qvqlqesgghlvkpggslklscaasgfafssfdmswirqtpekrlewvasitnvgtytyy
    pgsvkgrfsisrdnarntlnlqmsslrsedtalyfcarqgtaaqpywyfdvwgagttvtv
    s
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1qfwL (L:)
    dieltqspdslavslgqratiscrasesvdsygnsfmqwyqqkpgqppklliyrasnles
    giparfsgtgsrtdftltinpveaddvatyycqqsdeypymytfgggtkleikr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qfwL (L:)
    dieltqspdslavslgqratiscrasedsygnsfmqwyqqkpgqppklliyrasnlesgi
    parfsgtgsrtdftltinpveaddvatyycqqsdeypymytfgggtkleikr
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qfwM (M:)
    dieltqspksmsmsvgervtlsckasetvdsfvswyqqkpeqspkllifgasnrfsgvpd
    rftgsgsatdftltissvqaedfadyhcgqtynhpytfgggtkleikr