PDB entry 1qfr

View 1qfr on RCSB PDB site
Description: nmr solution structure of phosphocarrier protein hpr from enterococcus faecalis
Class: transport protein
Keywords: histidine containing phosphcarrier protein, enterococcus faecalis, nmr, protein
Deposited on 1999-04-13, released 2001-02-28
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR16
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phosphocarrier protein HPr
  Species: Enterococcus faecalis
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07515 (0-87)
    • conflict (88)
  Domains in SCOP 1.73: d1qfra_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qfrA (A:)
  mekkefhivaetgiharpatllvqtaskfnsdinleykgksvnlksimgvmslgvgqgsd
  vtitvdgadeaegmaaivetlqkeglaeq