PDB entry 1qfq

View 1qfq on RCSB PDB site
Description: bacteriophage lambda n-protein-nutboxb-RNA complex
Class: transcription/RNA
Keywords: bacteriophage lambda; antitermination; peptide-RNA-complex; n-nut; gnra tetraloop; bent-alpha-helix; peptide-RNA-recognition
Deposited on 1999-04-12, released 1999-04-20
The last revision prior to the SCOP 1.75 freeze date was dated 2005-01-04, with a file datestamp of 2007-06-04.
Experiment type: NMR29
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 15-mer nutRboxB RNA hairpin
    Species: synthetic, synthetic
  • Chain 'B':
    Compound: 36-mer N-terminal peptide of the N protein
    Species: BACTERIOPHAGE LAMBDA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qfqb_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qfqB (B:)
daqtrrrerraekqaqwkaanpllvgvsakpvnrp