PDB entry 1qfq

View 1qfq on RCSB PDB site
Description: bacteriophage lambda n-protein-nutboxb-rna complex
Deposited on 1999-04-12, released 1999-04-20
The last revision prior to the SCOP 1.65 freeze date was dated 1999-04-20, with a file datestamp of 1999-04-19.
Experiment type: NMR29
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Domains in SCOP 1.65: d1qfqb_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qfqB (B:)
    daqtrrrerraekqaqwkaanpllvgvsakpvnrp