PDB entry 1qfp

View 1qfp on RCSB PDB site
Description: n-terminal domain of sialoadhesin (mouse)
Class: immunoglobulin
Keywords: immunoglobulin superfamily, carbohydrate binding
Deposited on 1999-04-12, released 1999-04-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.198
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (sialoadhesin)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1qfpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qfpA (A:)
    twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
    dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvttd