PDB entry 1qfo

View 1qfo on RCSB PDB site
Description: n-terminal domain of sialoadhesin (mouse) in complex with 3'sialyllactose
Class: immune system
Keywords: immunoglobulin superfamily, carbohydrate binding, immune system
Deposited on 1999-04-12, released 1999-04-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.2
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (sialoadhesin)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PIR S50065 (0-End)
    Domains in SCOPe 2.01: d1qfoa_
  • Chain 'B':
    Compound: protein (sialoadhesin)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PIR S50065 (0-End)
    Domains in SCOPe 2.01: d1qfob_
  • Chain 'C':
    Compound: protein (sialoadhesin)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PIR S50065 (0-118)
    Domains in SCOPe 2.01: d1qfoc_
  • Heterogens: SIA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qfoA (A:)
    twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
    dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvttd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qfoA (A:)
    twgvsspknvqglsgscllipcifsypadvpvgitaiwyydysgkrqvvihsgdpklvdk
    rfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeissnrwldvkgttvtvtt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qfoB (B:)
    twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
    dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvttd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qfoB (B:)
    twgvsspknvqglsgscllipcifsypadvpvsgitaiwyydysgkrqvvihsgdpklvd
    krfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeissnrwldvkgttvtvtt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qfoC (C:)
    twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
    dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvttd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qfoC (C:)
    twgvsspknvqglsgscllipcifsypadvpgitaiwyydysgkrqvvihsgdpklvdkr
    frgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisnrwldvkgttvtvttd