PDB entry 1qfd

View 1qfd on RCSB PDB site
Description: nmr solution structure of alpha-amylase inhibitor (aai)
Class: inhibitor
Keywords: inhibitor
Deposited on 1999-04-08, released 1999-07-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (alpha-amylase inhibitor)
    Species: Amaranthus hypochondriacus [TaxId:28502]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qfda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qfdA (A:)
    cipkwnrcgpkmdgvpccepytctsdyygncs