PDB entry 1qdw

View 1qdw on RCSB PDB site
Description: n-terminal domain, voltage-gated potassium channel kv1.2 residues 33-119
Class: signaling protein
Keywords: voltage-gated potassium channel, tetramerization domain, intracellular gate, tetramer, signaling protein
Deposited on 1999-07-10, released 2000-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.223
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: kv1.2 voltage-gated potassium channel
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63142 (0-86)
  Domains in SCOPe 2.07: d1qdwa_
• Chain 'B':
  Compound: kv1.2 voltage-gated potassium channel
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63142 (0-86)
  Domains in SCOPe 2.07: d1qdwb_
• Chain 'C':
  Compound: kv1.2 voltage-gated potassium channel
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63142 (0-86)
  Domains in SCOPe 2.07: d1qdwc_
• Chain 'D':
  Compound: kv1.2 voltage-gated potassium channel
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63142 (0-86)
  Domains in SCOPe 2.07: d1qdwd_
• Chain 'E':
  Compound: kv1.2 voltage-gated potassium channel
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63142 (0-86)
  Domains in SCOPe 2.07: d1qdwe_
• Chain 'F':
  Compound: kv1.2 voltage-gated potassium channel
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63142 (0-86)
  Domains in SCOPe 2.07: d1qdwf_
• Chain 'G':
  Compound: kv1.2 voltage-gated potassium channel
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63142 (0-86)
  Domains in SCOPe 2.07: d1qdwg_
• Chain 'H':
  Compound: kv1.2 voltage-gated potassium channel
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63142 (0-86)
  Domains in SCOPe 2.07: d1qdwh_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qdwA (A:)
  ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
  qsggrlrrpvnvpldifseeirfyelg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qdwB (B:)
  ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
  qsggrlrrpvnvpldifseeirfyelg
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qdwC (C:)
  ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
  qsggrlrrpvnvpldifseeirfyelg
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qdwD (D:)
  ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
  qsggrlrrpvnvpldifseeirfyelg
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qdwE (E:)
  ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
  qsggrlrrpvnvpldifseeirfyelg
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qdwF (F:)
  ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
  qsggrlrrpvnvpldifseeirfyelg
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qdwG (G:)
  ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
  qsggrlrrpvnvpldifseeirfyelg
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qdwH (H:)
  ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
  qsggrlrrpvnvpldifseeirfyelg