PDB entry 1qdw

View 1qdw on RCSB PDB site
Description: n-terminal domain, voltage-gated potassium channel kv1.2 residues 33-119
Deposited on 1999-07-10, released 2000-09-20
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-20, with a file datestamp of 2000-09-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.223
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qdwa_
  • Chain 'B':
    Domains in SCOP 1.55: d1qdwb_
  • Chain 'C':
    Domains in SCOP 1.55: d1qdwc_
  • Chain 'D':
    Domains in SCOP 1.55: d1qdwd_
  • Chain 'E':
    Domains in SCOP 1.55: d1qdwe_
  • Chain 'F':
    Domains in SCOP 1.55: d1qdwf_
  • Chain 'G':
    Domains in SCOP 1.55: d1qdwg_
  • Chain 'H':
    Domains in SCOP 1.55: d1qdwh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qdwA (A:)
    ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qdwB (B:)
    ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qdwC (C:)
    ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qdwD (D:)
    ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qdwE (E:)
    ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qdwF (F:)
    ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qdwG (G:)
    ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qdwH (H:)
    ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg