PDB entry 1qdv

View 1qdv on RCSB PDB site
Description: n-terminal domain, voltage-gated potassium channel kv1.2 residues 33-131
Class: signaling protein
Keywords: voltage-gated potassium channel, tetramerization domain, intracellular gate, tetramer, signaling protein
Deposited on 1999-07-10, released 2000-09-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.238
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: kv1.2 voltage-gated potassium channel
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63142 (0-98)
  Domains in SCOPe 2.05: d1qdva_
• Chain 'B':
  Compound: kv1.2 voltage-gated potassium channel
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63142 (0-98)
  Domains in SCOPe 2.05: d1qdvb_
• Chain 'C':
  Compound: kv1.2 voltage-gated potassium channel
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63142 (0-98)
  Domains in SCOPe 2.05: d1qdvc_
• Chain 'D':
  Compound: kv1.2 voltage-gated potassium channel
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63142 (0-98)
  Domains in SCOPe 2.05: d1qdvd_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qdvA (A:)
  ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
  qsggrlrrpvnvpldifseeirfyelgeeamemfredeg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qdvB (B:)
  ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
  qsggrlrrpvnvpldifseeirfyelgeeamemfredeg
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qdvC (C:)
  ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
  qsggrlrrpvnvpldifseeirfyelgeeamemfredeg
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qdvD (D:)
  ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
  qsggrlrrpvnvpldifseeirfyelgeeamemfredeg