PDB entry 1qde

View 1qde on RCSB PDB site
Description: crystal structure of the atpase domain of translation initiation factor 4a from saccharomyces cerevisiae-the prototype of the dead box protein family
Deposited on 1999-05-20, released 2000-05-23
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-23, with a file datestamp of 2000-05-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qdea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qdeA (A:)
    iqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtgk
    tgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhaciggtsfve
    daeglrdaqivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftllp
    pttqvvllsatmpndvlevttkfmrnpvrilv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qdeA (A:)
    iqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtgk
    tgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhacigglrdaq
    ivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftllppttqvvlls
    atmpndvlevttkfmrnpvrilv