PDB entry 1qd0

View 1qd0 on RCSB PDB site
Description: camelid heavy chain variable domains provide efficient combining sites to haptens
Class: immune system
Keywords: camelid vh, immunoglobulin fragment, azo-dye, immune system
Deposited on 1999-07-08, released 2000-07-19
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.21
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vhh-r2 anti-rr6 antibody
    Species: Lama glama
    Database cross-references and differences (RAF-indexed):
    • GB CAA15412 (0-127)
      • conflict (28)
      • conflict (90)
      • conflict (106)
    Domains in SCOP 1.75: d1qd0a_
  • Heterogens: CU, RR6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qd0A (A:)
    qvqlqesggglvqaggslrlscaasgraasghghygmgwfrqvpgkerefvaairwsgke
    twykdsvkgrftisrdnakttvylqmnslkgedtavyycaarpvrvadislpvgfdywgq
    gtqvtvss