PDB entry 1qd0

View 1qd0 on RCSB PDB site
Description: camelid heavy chain variable domains provide efficient combining sites to haptens
Deposited on 1999-07-08, released 2000-07-19
The last revision prior to the SCOP 1.65 freeze date was dated 2000-07-19, with a file datestamp of 2000-07-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.21
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1qd0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qd0A (A:)
    qvqlqesggglvqaggslrlscaasgraasghghygmgwfrqvpgkerefvaairwsgke
    twykdsvkgrftisrdnakttvylqmnslkgedtavyycaarpvrvadislpvgfdywgq
    gtqvtvss