PDB entry 1qcv

View 1qcv on RCSB PDB site
Description: rubredoxin variant (pfrd-xc4) folds without iron
Class: electron transport
Keywords: hyperthermophile, rubredoxin, electron transport
Deposited on 1999-05-10, released 2000-02-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (rubredoxin variant pfrd-xc4)
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24297 (0-52)
      • mutation (4)
      • mutation (7)
      • mutation (37)
      • mutation (40)
    Domains in SCOPe 2.04: d1qcva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcvA (A:)
    akwvlkitgyiydedagdpdngispgtkfeelpddwvapitgapksefekled