PDB entry 1qcr

View 1qcr on RCSB PDB site
Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only
Class: oxidoreductase
Keywords: bc1, qcr, membrane protein, proton translocation, electron transfer, protease, mpp, mitochondrial processing peptidase, structure, cytochrome c1, cytochrome b, rieske, iron sulfer protein, oxidoreductase
Deposited on 1997-05-17, released 1998-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.3
AEROSPACI score: -1.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31800 (0-445)
      • conflict (427)
    Domains in SCOPe 2.06: d1qcra1, d1qcra2
  • Chain 'B':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qcrb1, d1qcrb2
  • Chain 'C':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qcrc2, d1qcrc3
  • Chain 'D':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qcrd2, d1qcrd3
  • Chain 'E':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qcre1, d1qcre2
  • Chain 'F':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qcrf_
  • Chain 'G':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qcrg_
  • Chain 'H':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qcrh_
  • Chain 'I':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00130 (0-58)
      • conflict (33)
    Domains in SCOPe 2.06: d1qcrj_
  • Chain 'K':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qcrk_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcrA (A:)
    tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
    hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
    sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
    dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsq
    ichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaat
    nklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknl
    lrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcp
    avagfgpveqlpdynrirsgmfwlrf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcrB (B:)
    vpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslt
    tkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwe
    vaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvq
    nhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyhggeireqngdslvhaa
    lvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqavakgvhqpfdvsafnasy
    sdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaaknklkagylmsvesse
    gfldevgsqalaagsytppstvlqqidavadadvinaakkfvsgrksmaasgnlghtpfi
    del
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcrC (C:)
    tnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttt
    afssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilll
    tvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffaf
    hfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalml
    lvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsilil
    alipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfll
    ilvlmptagtienkllkw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcrD (D:)
    evlefddgtpatmsqvakdvctflrwaaepehdhrkrmglkmllmmglllplvyamkrhk
    wsvlksrklayrppk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcrE (E:)
    shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcrF (F:)
    assrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikrald
    lsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcrG (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefeksk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcrH (H:)
    ttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahklfnsl
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcrJ (J:)
    tltarlysllfrrtstfaltivvgalfferafdngadaiyehinegklwkhikhkyenk
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcrK (K:)
    mltrflgpryrqlarnwvptaqlwgavgavglvsatdsrlildwv