PDB entry 1qcq

View 1qcq on RCSB PDB site
Description: ubiquitin conjugating enzyme
Class: ligase
Keywords: ubiquitin, ubiquitin-conjugating enzyme, yeast, ligase
Deposited on 1999-05-10, released 1999-05-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.24
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ubiquitin conjugating enzyme)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1qcqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcqA (A:)
    mssskriakelsdlerdpptscsagpvgddlyhwqasimgpadspyaggvfflsihfptd
    ypfkppkisfttkiyhpninangnicldilkdqwspaltlskvllsicslltdanpddpl
    vpeiahiyktdrpkyeatarewtkkyav