PDB entry 1qco

View 1qco on RCSB PDB site
Description: crystal structure of fumarylacetoacetate hydrolase complexed with fumarate and acetoacetate
Class: hydrolase
Keywords: mixed beta sandwich roll, hydrolase
Deposited on 1999-05-17, released 2000-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.159
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fumarylacetoacetate hydrolase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qcoa1, d1qcoa2
  • Chain 'B':
    Compound: fumarylacetoacetate hydrolase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35505 (2-End)
      • expression artifact (0-1)
    Domains in SCOPe 2.07: d1qcob1, d1qcob2, d1qcob3
  • Heterogens: CA, NI, FUM, AAE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qcoA (A:)
    gsmsfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskh
    qhvfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlp
    atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
    qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
    iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
    lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
    fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpalsp
    ags
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qcoA (A:)
    msfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskhqh
    vfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlpat
    igdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmgqm
    rpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsardiq
    qweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdinls
    vslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpesfg
    smlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qcoB (B:)
    gsmsfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskh
    qhvfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlp
    atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
    qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
    iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
    lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
    fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpalsp
    ags
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qcoB (B:)
    gsmsfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskh
    qhvfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlp
    atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
    qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
    iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
    lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
    fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpals