PDB entry 1qcn

View 1qcn on RCSB PDB site
Description: crystal structure of fumarylacetoacetate hydrolase
Class: hydrolase
Keywords: mixed beta sandwich roll, hydrolase
Deposited on 1999-05-14, released 2000-06-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fumarylacetoacetate hydrolase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35505
      • modified residue (2)
      • modified residue (72)
      • modified residue (116)
      • modified residue (141)
      • modified residue (178)
      • modified residue (181)
      • modified residue (199)
      • modified residue (203)
      • modified residue (229)
      • modified residue (232)
      • modified residue (267)
      • modified residue (271)
      • modified residue (309)
      • modified residue (323)
      • modified residue (327)
      • modified residue (363)
    Domains in SCOPe 2.06: d1qcna1, d1qcna2
  • Chain 'B':
    Compound: fumarylacetoacetate hydrolase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35505 (2-End)
      • expression artifact (0-1)
      • modified residue (2)
      • modified residue (72)
      • modified residue (116)
      • modified residue (141)
      • modified residue (178)
      • modified residue (181)
      • modified residue (199)
      • modified residue (203)
      • modified residue (229)
      • modified residue (232)
      • modified residue (267)
      • modified residue (271)
      • modified residue (309)
      • modified residue (323)
      • modified residue (327)
      • modified residue (363)
    Domains in SCOPe 2.06: d1qcnb1, d1qcnb2, d1qcnb3
  • Heterogens: CA, NI, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qcnA (A:)
    gsmsfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskh
    qhvfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlp
    atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
    qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
    iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
    lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
    fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpalsp
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qcnA (A:)
    msfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskhqh
    vfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlpat
    igdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmgqm
    rpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsardiq
    qweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdinls
    vslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpesfg
    smlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qcnB (B:)
    gsmsfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskh
    qhvfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlp
    atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
    qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
    iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
    lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
    fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpalsp
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qcnB (B:)
    gsmsfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskh
    qhvfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlp
    atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
    qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
    iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
    lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
    fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpalsp