PDB entry 1qcf

View 1qcf on RCSB PDB site
Description: crystal structure of hck in complex with a src family-selective tyrosine kinase inhibitor
Deposited on 1999-05-04, released 1999-06-08
The last revision prior to the SCOP 1.65 freeze date was dated 1999-06-08, with a file datestamp of 1999-06-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.215
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qcfA (A:)
    gamgsgiriivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsny
    varvdsleteewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqg
    dtvkhykirtldnggfyisprstfstlqelvdhykkgndglcqklsvpcmsskpqkpwek
    daweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveaflaeanvmktl
    qhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqiaegmafi
    eqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwtapeainfg
    sftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmr
    cwknrpeerptfeyiqsvlddfytatesqyeeip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qcfA (A:)
    sgiriivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarv
    dsleteewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvk
    hykirtldnggfyisprstfstlqelvdhykkgndglcqklsvpcmsskpqkpwekdawe
    ipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveaflaeanvmktlqhdk
    lvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqiaegmafieqrn
    yihrdlraanilvsaslvckiadfglarviedneytaregakfpikwtapeainfgsfti
    ksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcwkn
    rpeerptfeyiqsvlddfytatesqyeeip