PDB entry 1qcb

View 1qcb on RCSB PDB site
Description: escherichia coli heat labile enterotoxin type iib b-pentamer
Class: enterotoxin
Keywords: enterotoxin
Deposited on 1999-04-30, released 2003-06-10
The last revision prior to the SCOP 1.75 freeze date was dated 2003-06-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.193
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'D':
  Compound: protein (heat labile enterotoxin type iib b-pentamer)
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43529 (0-98)
  Domains in SCOP 1.75: d1qcbd_
• Chain 'E':
  Compound: protein (heat labile enterotoxin type iib b-pentamer)
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43529 (0-98)
  Domains in SCOP 1.75: d1qcbe_
• Chain 'F':
  Compound: protein (heat labile enterotoxin type iib b-pentamer)
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43529 (0-98)
  Domains in SCOP 1.75: d1qcbf_
• Chain 'G':
  Compound: protein (heat labile enterotoxin type iib b-pentamer)
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43529 (0-98)
  Domains in SCOP 1.75: d1qcbg_
• Chain 'H':
  Compound: protein (heat labile enterotoxin type iib b-pentamer)
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43529 (0-98)
  Domains in SCOP 1.75: d1qcbh_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qcbD (D:)
  gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
  taemrkiamaavlsgmrvnmcaspasspnviwaieleae
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qcbE (E:)
  gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
  taemrkiamaavlsgmrvnmcaspasspnviwaieleae
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qcbF (F:)
  gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
  taemrkiamaavlsgmrvnmcaspasspnviwaieleae
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qcbG (G:)
  gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
  taemrkiamaavlsgmrvnmcaspasspnviwaieleae
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qcbH (H:)
  gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
  taemrkiamaavlsgmrvnmcaspasspnviwaieleae