PDB entry 1qbt

View 1qbt on RCSB PDB site
Description: hiv-1 protease inhibitors wiih low nanomolar potency
Deposited on 1997-04-25, released 1997-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1997-10-15, with a file datestamp of 1997-10-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qbta_
  • Chain 'B':
    Domains in SCOP 1.55: d1qbtb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qbtA (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qbtB (B:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigatlnf