PDB entry 1qbr
View 1qbr on RCSB PDB site
Description: hiv-1 protease inhibitors wiih low nanomolar potency
Class: aspartyl protease
Keywords: hydrolase (acid proteinase), aspartyl protease
Deposited on
1997-04-25, released
1997-10-15
The last revision prior to the SCOP 1.73 freeze date was dated
1997-10-15, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.46
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d1qbra_ - Chain 'B':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d1qbrb_ - Heterogens: XV6
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1qbrA (A:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1qbrB (B:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigatlnf