PDB entry 1qbl

View 1qbl on RCSB PDB site
Description: fab e8 (fabe8a) x-ray structure at 2.26 angstrom resolution
Deposited on 1998-04-29, released 1998-12-02
The last revision prior to the SCOP 1.55 freeze date was dated 1998-12-02, with a file datestamp of 1998-12-02.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.192
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qblH (H:)
    evqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpekglewigridpasgntky
    dpkfqdkatitadtssntaylqlssltsedtavyycagydygnfdywgqgttltvssaet
    tppsvyplapgtaalkssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    ltssvtvpsstwpsqtvtcnvahpasstkvdkkivprnc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qblL (L:)
    diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
    rfsgsgsgtqyslkinslqpedfgsyycqhfwstpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec