PDB entry 1qa9

View 1qa9 on RCSB PDB site
Description: Structure of a Heterophilic Adhesion Complex Between the Human CD2 and CD58(LFA-3) Counter-Receptors
Deposited on 1999-04-13, released 1999-04-29
The last revision prior to the SCOP 1.55 freeze date was dated 1999-08-30, with a file datestamp of 1999-08-29.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.223
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qa9a_
  • Chain 'B':
    Domains in SCOP 1.55: d1qa9b_
  • Chain 'C':
    Domains in SCOP 1.55: d1qa9c_
  • Chain 'D':
    Domains in SCOP 1.55: d1qa9d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qa9A (A:)
    tnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdtyell
    kngalkikhlktddqdiykvsiydtkgknvlekifdlkiqer
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qa9B (B:)
    ssqqiygvkygnvtfhvpsnqplkevlwkkqkdkvaelensefrafssfknrvyldtksg
    sltiynltssdedeyemespnitdsmkfflyvges
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qa9C (C:)
    tnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdtyell
    kngalkikhlktddqdiykvsiydtkgknvlekifdlkiqer
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qa9D (D:)
    ssqqiygvkygnvtfhvpsnqplkevlwkkqkdkvaelensefrafssfknrvyldtksg
    sltiynltssdedeyemespnitdsmkfflyvges