PDB entry 1q9s

View 1q9s on RCSB PDB site
Description: Crystal structure of riboflavin kinase with ternary product complex
Class: transferase
Keywords: TRANSFERASE, BETA BARREL, RIBOFLAVIN, RIBOFLAVIN KINASE, FMN binding protein, complex
Deposited on 2003-08-25, released 2003-12-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.199
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein FLJ11149
    Species: Homo sapiens [TaxId:9606]
    Gene: FLJ11149
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q969G6 (0-148)
      • conflict (135)
    Domains in SCOPe 2.02: d1q9sa_
  • Heterogens: MG, ADP, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q9sA (A:)
    imrhlpyfcrgqvvrgfgrgskqlgiptanfpeqvvdnlpadistgiyygwasvgsgdvh
    kmvvsigwnpyykntkksmethimhtfkedfygeilnvaivgylrpeknfdsleslisai
    qgdieeakkrlelpeylkikednffqvsk