PDB entry 1q99

View 1q99 on RCSB PDB site
Description: crystal structure of the saccharomyces cerevisiae sr protein kinsae, sky1p, complexed with the non-hydrolyzable atp analogue, amp-pnp
Deposited on 2003-08-22, released 2003-09-23
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-23, with a file datestamp of 2003-09-23.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.22
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1q99a_
  • Chain 'B':
    Domains in SCOP 1.67: d1q99b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q99A (A:)
    dyrpggyhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyte
    aaedeikllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllali
    kkyehrgipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikia
    dlgnacwydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeg
    hsytkdddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvlteky
    kfskdeakeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdi
    pgwfeevrdhkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q99A (A:)
    gyhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaede
    ikllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkyeh
    rgipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgna
    cwydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfetkdddhiaq
    iiellgelpsyllrngkytrtffnsllrnisklkfwpledvltekykfskdeakeisdfl
    spmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwfeevr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q99B (B:)
    dyrpggyhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyte
    aaedeikllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllali
    kkyehrgipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikia
    dlgnacwydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeg
    hsytkdddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvlteky
    kfskdeakeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdi
    pgwfeevrdhkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q99B (B:)
    ggyhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaed
    eikllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkye
    hrgipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgn
    acwydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeghsyt
    kdddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvltekykfsk
    deakeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwf
    eevr