PDB entry 1q8z

View 1q8z on RCSB PDB site
Description: The apoenzyme structure of the yeast SR protein kinase, Sky1p
Class: transferase
Keywords: disallowed, kinase, TRANSFERASE
Deposited on 2003-08-22, released 2003-09-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.221
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SR protein kinase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SKY1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03656 (Start-166)
      • see remark 999 (167-168)
    • Uniprot Q03656 (169-End)
    Domains in SCOPe 2.03: d1q8za_
  • Chain 'B':
    Compound: SR protein kinase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SKY1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03656 (Start-166)
      • see remark 999 (167-168)
    • Uniprot Q03656 (169-End)
    Domains in SCOPe 2.03: d1q8zb_
  • Heterogens: SO4, EDO, MOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q8zA (A:)
    dyrpggyhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyte
    aaedeikllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllali
    kkyehrgipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikia
    dlgnacwydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeg
    hsytkdddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvlteky
    kfskdeakeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdi
    pgwfeevrdhkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q8zA (A:)
    gyhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaede
    ikllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkyeh
    rgipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgna
    cwydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfetkdddhiaq
    iiellgelpsyllrngkytrtffnsllrnisklkfwpledvltekykfskdeakeisdfl
    spmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwfeevr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q8zB (B:)
    dyrpggyhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyte
    aaedeikllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllali
    kkyehrgipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikia
    dlgnacwydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeg
    hsytkdddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvlteky
    kfskdeakeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdi
    pgwfeevrdhkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q8zB (B:)
    ggyhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaed
    eikllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkye
    hrgipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgn
    acwydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeghsyt
    kdddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvltekykfsk
    deakeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwf
    eevr