PDB entry 1q84

View 1q84 on RCSB PDB site
Description: Crystal structure of the mouse acetylcholinesterase-TZ2PA6 anti complex
Class: hydrolase
Keywords: HYDROLASE, SERINE ESTERASE, ACETYLCHOLINESTERASE, bifunctional inhibitor
Deposited on 2003-08-20, released 2004-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.185
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Mus musculus [TaxId:10090]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q84a_
  • Chain 'B':
    Compound: acetylcholinesterase
    Species: Mus musculus [TaxId:10090]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q84b_
  • Heterogens: NAG, P6G, TZ4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q84A (A:)
    mrppwyplhtpslafpllflllsllgggaraegredpqllvrvrggqlrgirlkapggpv
    saflgipfaeppvgsrrfmppepkrpwsgvldattfqnvcyqyvdtlypgfegtemwnpn
    relsedclylnvwtpyprpasptpvliwiygggfysgaasldvydgrflaqvegavlvsm
    nyrvgtfgflalpgsreapgnvglldqrlalqwvqeniaafggdpmsvtlfgesagaasv
    gmhilslpsrslfhravlqsgtpngpwatvsagearrratllarlvgcppggaggndtel
    iaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgdflsdtpealintgdfqdlqvlvg
    vvkdegsyflvygvpgfskdneslisraqflagvrigvpqasdlaaeavvlhytdwlhpe
    dpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvyayifehrastltwplwmgvphgy
    eiefifglpldpslnytteerifaqrlmkywtnfartgdpndprdskspqwppyttaaqq
    yvslnlkplevrrglraqtcafwnrflpkllsatdtldea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q84A (A:)
    egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
    dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
    ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
    qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
    agearrratllarlvgcpgndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdg
    dflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvri
    gvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarv
    yayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfar
    tgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpklls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q84B (B:)
    mrppwyplhtpslafpllflllsllgggaraegredpqllvrvrggqlrgirlkapggpv
    saflgipfaeppvgsrrfmppepkrpwsgvldattfqnvcyqyvdtlypgfegtemwnpn
    relsedclylnvwtpyprpasptpvliwiygggfysgaasldvydgrflaqvegavlvsm
    nyrvgtfgflalpgsreapgnvglldqrlalqwvqeniaafggdpmsvtlfgesagaasv
    gmhilslpsrslfhravlqsgtpngpwatvsagearrratllarlvgcppggaggndtel
    iaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgdflsdtpealintgdfqdlqvlvg
    vvkdegsyflvygvpgfskdneslisraqflagvrigvpqasdlaaeavvlhytdwlhpe
    dpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvyayifehrastltwplwmgvphgy
    eiefifglpldpslnytteerifaqrlmkywtnfartgdpndprdskspqwppyttaaqq
    yvslnlkplevrrglraqtcafwnrflpkllsatdtldea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q84B (B:)
    edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
    tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
    ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
    qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
    arrratllarlvgcpndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgdfls
    dtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrigvpq
    asdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvyayi
    fehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfartgdp
    ndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll