PDB entry 1q6m

View 1q6m on RCSB PDB site
Description: the structure of phosphotyrosine phosphatase 1b in complex with compound 3
Class: hydrolase
Keywords: phosphatase, secondary binding site, selectivity, hydrolase
Deposited on 2003-08-13, released 2003-09-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-tyrosine phosphatase, non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN1 OR PTP1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031 (12-End)
      • cloning artifact (8-11)
    Domains in SCOPe 2.04: d1q6ma_
  • Heterogens: P27, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q6mA (A:)
    mdykddddklefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrd
    vspfdhsriklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvv
    mlnrvmekgslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqet
    reilhfhyttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcla
    dtclllmdkrkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvq
    dqwkelshed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q6mA (A:)
    klefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsr
    iklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmek
    gslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhy
    ttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmd
    krkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgds