PDB entry 1q60

View 1q60 on RCSB PDB site
Description: Solution Structure of RSGI RUH-004, a GTF2I domain in Mouse cDNA
Class: structural genomics, unknown function
Keywords: TFII-I, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-08-12, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: General transcription factor II-I
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2810454O07
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ESZ8 (7-92)
      • cloning artifact (0-6)
      • see remark 999 (22)
      • cloning artifact (93-98)
    Domains in SCOPe 2.07: d1q60a1, d1q60a2, d1q60a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1q60A (A:)
gssgssglkqkvenlfnekcgealglkqavkvpfalfesfpedfyveglpegvpfrrpst
fgiprlekilrnkakikfiikkpemfetaikessgpssg