PDB entry 1q5r

View 1q5r on RCSB PDB site
Description: The Rhodococcus 20S proteasome with unprocessed pro-peptides
Class: hydrolase
Keywords: proteasome assembly, pro-peptide, inter-subunit contacts, Rhodococcus erythropolis, HYDROLASE
Deposited on 2003-08-08, released 2003-12-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.229
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proteasome alpha-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCA(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q5ra_
  • Chain 'B':
    Compound: proteasome alpha-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCA(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q5rb_
  • Chain 'C':
    Compound: proteasome alpha-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCA(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q5rc_
  • Chain 'D':
    Compound: proteasome alpha-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCA(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q5rd_
  • Chain 'E':
    Compound: proteasome alpha-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCA(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q5re_
  • Chain 'F':
    Compound: proteasome alpha-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCA(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q5rf_
  • Chain 'G':
    Compound: proteasome alpha-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCA(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q5rg_
  • Chain 'H':
    Compound: proteasome beta-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCB(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q5rh_
  • Chain 'I':
    Compound: proteasome beta-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCB(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q5ri_
  • Chain 'J':
    Compound: proteasome beta-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCB(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q5rj_
  • Chain 'K':
    Compound: proteasome beta-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCB(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q5rk_
  • Chain 'L':
    Compound: proteasome beta-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCB(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q5rl_
  • Chain 'M':
    Compound: proteasome beta-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCB(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q5rm_
  • Chain 'N':
    Compound: proteasome beta-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCB(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q5rn_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q5rA (A:)
    mhhhhhhsaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
    gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
    eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
    vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
    esapepkpdtetkpadtqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5rA (A:)
    aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
    nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
    rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
    rqggvdvaslevavldqsrprrafrriagtaleqlvpae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q5rB (B:)
    mhhhhhhsaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
    gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
    eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
    vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
    esapepkpdtetkpadtqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5rB (B:)
    aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
    nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
    rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
    rqggvdvaslevavldqsrprrafrriagtaleqlvpae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q5rC (C:)
    mhhhhhhsaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
    gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
    eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
    vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
    esapepkpdtetkpadtqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5rC (C:)
    aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
    nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
    rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
    rqggvdvaslevavldqsrprrafrriagtaleqlvpae
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q5rD (D:)
    mhhhhhhsaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
    gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
    eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
    vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
    esapepkpdtetkpadtqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5rD (D:)
    aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
    nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
    rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
    rqggvdvaslevavldqsrprrafrriagtaleqlvpae
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1q5rE (E:)
    mhhhhhhsaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
    gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
    eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
    vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
    esapepkpdtetkpadtqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5rE (E:)
    aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
    nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
    rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
    rqggvdvaslevavldqsrprrafrriagtaleqlvpae
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1q5rF (F:)
    mhhhhhhsaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
    gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
    eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
    vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
    esapepkpdtetkpadtqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5rF (F:)
    aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
    nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
    rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
    rqggvdvaslevavldqsrprrafrriagtaleqlvpae
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1q5rG (G:)
    mhhhhhhsaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
    gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
    eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
    vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
    esapepkpdtetkpadtqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5rG (G:)
    aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
    nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
    rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
    rqggvdvaslevavldqsrprrafrriagtaleqlvpae
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1q5rH (H:)
    mtadrpalrtgdrdtrlsfgsnlssftdylrghapellpenrighrshstrggdgmesgd
    laphgttivaltykggvllagdrratqgnliasrdveavyvtdeysaagiagtagiaiel
    vrlfavelehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddes
    ragrivsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaa
    dddsatggpdltrgiyptavtitqagavhvseettselarrivaerteqggsar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5rH (H:)
    lsfgsnlssftdylrghapellpenrdlaphgttivaltykggvllagdrratqgnlias
    rdveavyvtdeysaagiagtagiaielvrlfavelehyekiegvpltfdgkanrlasmvr
    gnlgaamqglavvpllvgydldaddesragrivsydvvggryeeragyhavgsgslfaks
    alkkiyspdsdeetalraaieslydaadddsatggpdltrgiyptavtitqagavhvsee
    ttselarriva
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1q5rI (I:)
    mtadrpalrtgdrdtrlsfgsnlssftdylrghapellpenrighrshstrggdgmesgd
    laphgttivaltykggvllagdrratqgnliasrdveavyvtdeysaagiagtagiaiel
    vrlfavelehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddes
    ragrivsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaa
    dddsatggpdltrgiyptavtitqagavhvseettselarrivaerteqggsar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5rI (I:)
    lsfgsnlssftdylrghapellpenrdlaphgttivaltykggvllagdrratqgnlias
    rdveavyvtdeysaagiagtagiaielvrlfavelehyekiegvpltfdgkanrlasmvr
    gnlgaamqglavvpllvgydldaddesragrivsydvvggryeeragyhavgsgslfaks
    alkkiyspdsdeetalraaieslydaadddsatggpdltrgiyptavtitqagavhvsee
    ttselarriva
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1q5rJ (J:)
    mtadrpalrtgdrdtrlsfgsnlssftdylrghapellpenrighrshstrggdgmesgd
    laphgttivaltykggvllagdrratqgnliasrdveavyvtdeysaagiagtagiaiel
    vrlfavelehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddes
    ragrivsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaa
    dddsatggpdltrgiyptavtitqagavhvseettselarrivaerteqggsar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5rJ (J:)
    lsfgsnlssftdylrghapellpenrdlaphgttivaltykggvllagdrratqgnlias
    rdveavyvtdeysaagiagtagiaielvrlfavelehyekiegvpltfdgkanrlasmvr
    gnlgaamqglavvpllvgydldaddesragrivsydvvggryeeragyhavgsgslfaks
    alkkiyspdsdeetalraaieslydaadddsatggpdltrgiyptavtitqagavhvsee
    ttselarriva
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1q5rK (K:)
    mtadrpalrtgdrdtrlsfgsnlssftdylrghapellpenrighrshstrggdgmesgd
    laphgttivaltykggvllagdrratqgnliasrdveavyvtdeysaagiagtagiaiel
    vrlfavelehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddes
    ragrivsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaa
    dddsatggpdltrgiyptavtitqagavhvseettselarrivaerteqggsar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5rK (K:)
    lsfgsnlssftdylrghapellpenrdlaphgttivaltykggvllagdrratqgnlias
    rdveavyvtdeysaagiagtagiaielvrlfavelehyekiegvpltfdgkanrlasmvr
    gnlgaamqglavvpllvgydldaddesragrivsydvvggryeeragyhavgsgslfaks
    alkkiyspdsdeetalraaieslydaadddsatggpdltrgiyptavtitqagavhvsee
    ttselarriva
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1q5rL (L:)
    mtadrpalrtgdrdtrlsfgsnlssftdylrghapellpenrighrshstrggdgmesgd
    laphgttivaltykggvllagdrratqgnliasrdveavyvtdeysaagiagtagiaiel
    vrlfavelehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddes
    ragrivsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaa
    dddsatggpdltrgiyptavtitqagavhvseettselarrivaerteqggsar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5rL (L:)
    lsfgsnlssftdylrghapellpenrdlaphgttivaltykggvllagdrratqgnlias
    rdveavyvtdeysaagiagtagiaielvrlfavelehyekiegvpltfdgkanrlasmvr
    gnlgaamqglavvpllvgydldaddesragrivsydvvggryeeragyhavgsgslfaks
    alkkiyspdsdeetalraaieslydaadddsatggpdltrgiyptavtitqagavhvsee
    ttselarriva
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1q5rM (M:)
    mtadrpalrtgdrdtrlsfgsnlssftdylrghapellpenrighrshstrggdgmesgd
    laphgttivaltykggvllagdrratqgnliasrdveavyvtdeysaagiagtagiaiel
    vrlfavelehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddes
    ragrivsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaa
    dddsatggpdltrgiyptavtitqagavhvseettselarrivaerteqggsar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5rM (M:)
    lsfgsnlssftdylrghapellpenrdlaphgttivaltykggvllagdrratqgnlias
    rdveavyvtdeysaagiagtagiaielvrlfavelehyekiegvpltfdgkanrlasmvr
    gnlgaamqglavvpllvgydldaddesragrivsydvvggryeeragyhavgsgslfaks
    alkkiyspdsdeetalraaieslydaadddsatggpdltrgiyptavtitqagavhvsee
    ttselarriva
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1q5rN (N:)
    mtadrpalrtgdrdtrlsfgsnlssftdylrghapellpenrighrshstrggdgmesgd
    laphgttivaltykggvllagdrratqgnliasrdveavyvtdeysaagiagtagiaiel
    vrlfavelehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddes
    ragrivsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaa
    dddsatggpdltrgiyptavtitqagavhvseettselarrivaerteqggsar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5rN (N:)
    lsfgsnlssftdylrghapellpenrdlaphgttivaltykggvllagdrratqgnlias
    rdveavyvtdeysaagiagtagiaielvrlfavelehyekiegvpltfdgkanrlasmvr
    gnlgaamqglavvpllvgydldaddesragrivsydvvggryeeragyhavgsgslfaks
    alkkiyspdsdeetalraaieslydaadddsatggpdltrgiyptavtitqagavhvsee
    ttselarriva