PDB entry 1q5k

View 1q5k on RCSB PDB site
Description: crystal structure of Glycogen synthase kinase 3 in complexed with inhibitor
Class: transferase
Keywords: kinase-inhibitor complex, TRANSFERASE
Deposited on 2003-08-08, released 2004-08-10
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.222
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1q5ka_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1q5kb_
  • Heterogens: TMU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q5kA (A:)
    ttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngs
    fgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssgekkdev
    ylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichrdikpqn
    llldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidvwsagcv
    laelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahpwtkvfr
    prtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalfnfttqe
    lssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5kA (A:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffysskkdevylnlvldyvpetvyrvarhysrakqtlpvi
    yvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsy
    icsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtp
    treqiremnpefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsf
    fdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q5kB (B:)
    ttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngs
    fgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssgekkdev
    ylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichrdikpqn
    llldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidvwsagcv
    laelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahpwtkvfr
    prtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalfnfttqe
    lssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5kB (B:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
    viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
    syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
    tptreqiremnpefkfpahpwtkvfrprtppeaialcsrlleytptarltpleacahsff
    delrdpnvklpngrdtpalfnfttqelssnpplatilipphari