PDB entry 1q4l

View 1q4l on RCSB PDB site
Description: GSK-3 Beta complexed with Inhibitor I-5
Class: transferase
Keywords: kinase, insulin pathway
Deposited on 2003-08-04, released 2003-10-14
The last revision prior to the SCOP 1.73 freeze date was dated 2003-10-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.77 Å
R-factor: 0.212
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: HOMO SAPIENS
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1q4la_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: HOMO SAPIENS
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1q4lb_
  • Heterogens: 679, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q4lA (A:)
    gplgssgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsy
    tdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryff
    yssgekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfg
    ichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdyts
    sidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqi
    kahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdt
    palfnfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasa
    snst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q4lA (A:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssgdevylnlvldyvpetvyrvarhysrakqtlpviy
    vklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyi
    csryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtpt
    reqiremnfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelr
    dpnvklpngrdtpalfnfttqelssnpplatilipphariqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q4lB (B:)
    gplgssgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsy
    tdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryff
    yssgekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfg
    ichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdyts
    sidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqi
    kahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdt
    palfnfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasa
    snst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q4lB (B:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssgdevylnlvldyvpetvyrvarhysrakqtlpviy
    vklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyi
    csryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtpt
    reqiremnpnytepwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdp
    nvklpngrdtpalfnfttqelssnpplatilipphar