PDB entry 1q4j

View 1q4j on RCSB PDB site
Description:
Deposited on 2003-08-04, released 2003-11-25
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-20, with a file datestamp of 2004-01-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.213
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1q4ja1, d1q4ja2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1q4jb1, d1q4jb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q4jA (A:)
    mgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvp
    ilqigdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntnlfkqne
    ttflnedlpkwsgyfekllkknhtnnnndkyyfvgnnltyadlavfnlyddietkypssl
    knfpllkahnefisnlpniknyitnrkesvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q4jA (A:)
    dnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvpil
    qigdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntnlfkqnett
    flnedlpkwsgyfekllkknhtnnnndkyyfvgnnltyadlavfnlyddietkypsslkn
    fpllkahnefisnlpniknyitnrkesvy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q4jB (B:)
    mgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvp
    ilqigdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntnlfkqne
    ttflnedlpkwsgyfekllkknhtnnnndkyyfvgnnltyadlavfnlyddietkypssl
    knfpllkahnefisnlpniknyitnrkesvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q4jB (B:)
    dnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvpil
    qigdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntnlfkqnett
    flnedlpkwsgyfekllkknhtnnnndkyyfvgnnltyadlavfnlyddietkypsslkn
    fpllkahnefisnlpniknyitnrkesvy