PDB entry 1q44

View 1q44 on RCSB PDB site
Description: crystal structure of an arabidopsis thaliana putative steroid sulfotransferase
Deposited on 2003-08-01, released 2003-11-25
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-25, with a file datestamp of 2003-11-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1q44a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q44A (A:)
    msssssvpaylgdedltqetralisslpkekgwlvseiyefqglwhtqailqgilicqkr
    feakdsdiilvtnpksgttwlkalvfallnrhkfpvsssgnhpllvtnphllvpflegvy
    yespdfdfsslpsprlmnthishlslpesvksssckivyccrnpkdmfvslwhfgkklap
    eetadypiekaveafcegkfiggpfwdhileywyasrenpnkvlfvtyeelkkqtevemk
    riaeflecgfieeeevreivklcsfeslsnlevnkegklpngietktffrkgeiggwrdt
    lseslaeeidrtieekfkgsglkfss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q44A (A:)
    svpaylgdedltqetralisslpkekgwlvseiyefqglwhtqailqgilicqkrfeakd
    sdiilvtnpksgttwlkalvfallnrhkfpvsssgnhpllvtnphllvpflegvyyespd
    fdfsslpsprlmnthishlslpesvksssckivyccrnpkdmfvslwhfgkklypiekav
    eafcegkfiggpfwdhileywyasrenpnkvlfvtyeelkkqtevemkriaeflecgfie
    eeevreivklcsfegwrdtlseslaeeidrtieekfkgsglkfs